IGF-1 LR3

• Milligrams per Vial: 1 mg/vial
• Molecular Weight: Approximately 9200 g/mol.
• Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Physical Form: Lyophilized powder
• Solubility: Soluble in water

IGF-1 LR3 (Insulin-Like Growth Factor-1 Long R3)

IGF-1 LR3 is a synthetic analog of insulin-like growth factor-1 (IGF-1) that is modified for enhanced biological activity and extended half-life. It is known for its potent effects on cell growth, proliferation, and differentiation, making it a valuable tool in research related to growth and development. IGF-1 LR3 is supplied in a highly purified lyophilized form for research purposes.

Key Features:

• Enhanced Biological Activity: IGF-1 LR3 has enhanced biological activity compared to native IGF-1, making it more potent in stimulating cell growth and proliferation.
• Extended Half-Life: The modified structure of IGF-1 LR3 extends its half-life in the body, allowing for longer-lasting effects and reduced dosing frequency.
• Cell Growth and Differentiation: IGF-1 LR3 is known for its role in promoting cell growth, proliferation, and differentiation, offering insights into cellular mechanisms and potential therapeutic applications.

Applications:

• Cell Culture Studies: Ideal for studying the effects of IGF-1 LR3 on cell growth, proliferation, and differentiation in vitro, providing valuable insights into cellular biology.
• Muscle Growth Research: Investigates the role of IGF-1 LR3 in muscle growth and development, offering potential applications in muscle wasting conditions and performance enhancement.
• Regenerative Medicine: Explores the regenerative properties of IGF-1 LR3 in tissue repair and regeneration, contributing to research in wound healing and tissue engineering.

Safety and Usage:

• Storage Conditions: Store product in a cool, dry place away from direct light. Proper storage helps maintain the stability and effectiveness of the peptide.
• Handling Precautions: Handle with care to avoid contamination and degradation. Use sterile equipment and follow proper laboratory protocols.

Why Choose IGF-1 LR3 from Our Lab:

We provide high-quality IGF-1 LR3, ensuring each batch meets stringent quality standards for purity and potency. Our product is backed by comprehensive support and documentation, helping researchers achieve reliable results in their experimental endeavors.

Please Note: This product is exclusively for research purposes and not approved for human or veterinary use. It must be used only by qualified researchers in professional settings. It is not for human consumption or clinical application on animals.